PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013627192.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 472aa    MW: 53179.4 Da    PI: 6.4286
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013627192.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.61.9e-1558101448
                      S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      WTteEde+l ++v ++  ++Wk++a+ ++  Rt+ qc +rwqk+l
   XP_013627192.1  58 WTTEEDEILRQGVCRFKAKSWKKVAEFLP-DRTEVQCMHRWQKVL 101
                      *****************************.************986 PP

2Myb_DNA-binding59.85.8e-19107153148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g WT++Ede +v++v+++G++ W++I++ ++ gR +kqc++rw+++l
   XP_013627192.1 107 KGHWTQQEDETIVELVEKYGPKKWSLISQSLP-GRIGKQCRERWYNHL 153
                      789*****************************.*************97 PP

3Myb_DNA-binding56.56.5e-18159202146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      + +WT+eE++ l++a+  +G++ W+ Ia+ ++ gRt++++k++w++
   XP_013627192.1 159 KEAWTPEEELALLNAHVIYGNK-WAEIAKVLP-GRTDNSIKNHWNS 202
                      579*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.13450101IPR017930Myb domain
SuperFamilySSF466893.18E-1653111IPR009057Homeodomain-like
SMARTSM007171.6E-1254103IPR001005SANT/Myb domain
PfamPF002494.6E-1458101IPR001005SANT/Myb domain
CDDcd001676.81E-1258101No hitNo description
Gene3DG3DSA:1.10.10.604.2E-2158113IPR009057Homeodomain-like
PROSITE profilePS5129430.035102157IPR017930Myb domain
SuperFamilySSF466899.54E-32104200IPR009057Homeodomain-like
SMARTSM007172.6E-18106155IPR001005SANT/Myb domain
PfamPF002498.7E-18107153IPR001005SANT/Myb domain
CDDcd001673.72E-15110153No hitNo description
Gene3DG3DSA:1.10.10.601.3E-25114160IPR009057Homeodomain-like
PROSITE profilePS5129422.389158208IPR017930Myb domain
SMARTSM007171.5E-17158206IPR001005SANT/Myb domain
PfamPF002493.6E-16159202IPR001005SANT/Myb domain
CDDcd001675.30E-13161204No hitNo description
Gene3DG3DSA:1.10.10.601.9E-22161207IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 472 aa     Download sequence    Send to blast
MEDECIESKQ STAVSPSSVS EGSSSSFLKS PGAVPTATVS STHRRTSGPM RRTKGAGWTT  60
EEDEILRQGV CRFKAKSWKK VAEFLPDRTE VQCMHRWQKV LDPNLNKGHW TQQEDETIVE  120
LVEKYGPKKW SLISQSLPGR IGKQCRERWY NHLNPCINKE AWTPEEELAL LNAHVIYGNK  180
WAEIAKVLPG RTDNSIKNHW NSSLKKKSEF LLANGSLPPT PKYATTKPTP AKPVMAVTTS  240
AKNGVLDGAT TQLNKPNEEG KDQSNSSVLP QEVVAASPVT SVSEYACSPQ LPNPENGYQR  300
YYKPQREQYM ASEADKQRMY GYEYGCSPST PPVIFFTPPP PCRKEYSNGS ARTSLESFLR  360
EAARTFPNMP SIIRKRPRKF VVAPDHNKTD EEEGTKEVVD EKVTTDCEEE EEEEEEEEEK  420
QNNGSNAYYI SPPYRIGSKG RAVFKSRQLE FITAEEEKAD DETKLPEKDK VA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C2e-63582079158MYB PROTO-ONCOGENE PROTEIN
1h89_C2e-63582079158MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1893940.0AC189394.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB055G10, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013627192.10.0PREDICTED: myb-related protein 3R-1-like
TrEMBLA0A0D3BAD90.0A0A0D3BAD9_BRAOL; Uncharacterized protein
STRINGBra001311.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16672887
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G09370.21e-170myb domain protein 3r-3